PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_64362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family bZIP
Protein Properties Length: 295aa    MW: 32710.8 Da    PI: 10.4938
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_64362.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.6e-1182140563
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                   kr++r + NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l+ l+   + l++e+
  MLOC_64362.1  82 KRAKRIMANRQSAARSKERKMRYIAELERKVQCLQTEATTLSAQLSLLQRDTSGLTNEN 140
                   9***********************************************99988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-1778142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.72680143IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-1182133No hitNo description
PfamPF001701.4E-982139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-1182137No hitNo description
CDDcd147038.12E-2083132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MFEMFLQAGG RLSEPLEPSP SPYPQQPSPP PPARPRHQHS MSMDGSTSFA SASSGASGRH  60
GADAKKAISD AKLAELALVD PKRAKRIMAN RQSAARSKER KMRYIAELER KVQCLQTEAT  120
TLSAQLSLLQ RDTSGLTNEN GDLKLQVQTM EQQVRLQDAL NDRLRDEVQQ LKIATGQLNA  180
NNGNLGNLGG LSSYGLNPQM SYQRRSQMQQ SLLAAQQLQQ LQIHSHHQQQ QQPQMHLQQQ  240
QRVGSVRQQQ QQQQLQSQLR PEALPFPGDL KMKGIAMTAH VQNAGPLDGH ARSEP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668880.0AK366888.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047M20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448110.11e-108hypothetical protein SORBIDRAFT_06g021350
SwissprotQ040884e-68POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0XZ410.0M0XZ41_HORVD; Uncharacterized protein
TrEMBLF2DSM00.0F2DSM0_HORVD; Predicted protein
STRINGMLOC_64362.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.17e-56bZIP family protein